PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG034992t1
Common NameTCM_034992
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 388aa    MW: 44431.7 Da    PI: 10.2576
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG034992t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.72.9e-14317359547
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                       +r++r++kNRe+A rsR+RK+a++ +Le +v++L + N+ Lk 
  Thecc1EG034992t1 317 RRQKRMIKNRESAARSRARKQAYTNQLEVEVDQLRKMNSWLKR 359
                       79************************************98884 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.6E-10313381IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.094315360IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.0E-13317366No hitNo description
CDDcd147071.04E-23317362No hitNo description
PfamPF001703.7E-12317360IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.81E-10317362No hitNo description
PROSITE patternPS000360320335IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MGNLFSFSLS HARTLKIGFS STNPHLPDRF QRLLRSFWRF RYYFSTAIYS HHFLHKPCIF  60
FPFFGWLYVT VFLYLKLFMM SPDRARGQRF PPLARQSSLY NLTFDEVQSQ LGNIGKPLNA  120
MNLDELLKSV IAVEGQLVQN PSSSSSSASF FLGNFNLNGT LRKKTVDEVW KEIVDHGNVN  180
AMDNQFVQQQ LTLGETTLED FLVRAGVINT ASQNGVLDPQ QFMAIDPVAV VSQQADWLQF  240
QMATVQQQQQ QQMTMMDSNF NVPDSSVYEG QVVDVGYPKN QLAMTMLPAM SATSQDSQAT  300
TARKRRCSDV MEKTIERRQK RMIKNRESAA RSRARKQAYT NQLEVEVDQL RKMNSWLKRQ  360
KEVNMLLSSN TIAQPKYQLR RTSSASF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007018899.10.0Abscisic acid responsive element-binding factor 1, putative
TrEMBLA0A061FNM50.0A0A061FNM5_THECC; Abscisic acid responsive element-binding factor 1, putative
STRINGPOPTR_0002s09140.11e-103(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17216911
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G41070.33e-56bZIP family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]